Prenumerera på vårt nyhetsbrev!

Missa inga nyheter och erbjudanden från Kurera!
Vårt nyhetsbrev kommer två gånger i veckan och är helt gratis.
Anmäl dig genom att fylla i dina uppgifter här:

E-postadressen är nu registrerad, du kommer att få vårt nästa utskick!

ljushårig kvinna håller fram ett äpple i höger hand och en glaserad munk i vänstra handen

Varför man kan äta skräpmat – och ändå inte bli mätt…

Du kan äta en hel massa skräpmat men är konstigt nog fortfarande hungrig. Trots att du nyss moffat i dig nära 2 000 kalorier känner du dig... ja, liksom inte nöjd.
Anledningen till detta, visar studier, är att din kropp vet saker som din hjärna inte vet.

Mättnad, alltså den mekanism som hindrar oss från att äta mer än vad vi behöver, har mindre att göra med kaloriintag och mer att göra med intag av särskilda makronäringsämnen – typer av protein, kolhydrater och fett – och den faktiska volymen mat, visar studier.

Kortvarig mättnad
När vi äter upp ett helt paket kakor får vi i oss mängder av kalorier, men inte den näring vi behöver för högkvalitativ, hållbar energi.
Och även om det kan tyckas en stor mängd mat (nåja, kakor) så rör den sig också snabbt genom oss, vilket innebär att mättnadskänslan inte heller håller i sig så länge.

LÄS OCKSÅ: Det här händer i kroppen när du äter en Big Mac

Vilken mättnadsgrad olika typer av kost ger oss beror delvis på dess näringsdensitet, alltså förhållandet mellan näringsämnen och kalorier. Trots att skräpmat är kaloririk förser den oss alltså bara med en mycket liten del näringsämnen i förhållande till mängden mat.

 

– Ofta när livsmedel inte ger oss nog mättnad beror det på att de inte är tillräckligt fiberrika, att de är för lättsmälta eller att de inte förser vår kropp med en jämn mängd kalorier under den tid matsmältningen tar, matsmältningen, säger Jeremy Furtado, forskare vid Harvard University, till Huffington Post.

Mängden näring avgör kvaliteten på mättnaden
Protein och kostfiber är avgörande för att kunna bromsa matsmältningen och frigöra energi under en längre period.
Även vitaminer och mineraler kan påverka hur mätta vi känner oss. Om din kropp inte får i sig de näringsämnen den behöver kan det göra att den fortsätter att skicka dig hungersignaler, i hopp om att du denna gång ska välja något mer näringsrikt

Skräpmat består i allmänhet av väldigt processade ingredienser som saknar både den makronäring du behöver för att känna dig mätt och naturligt förekommande vitaminer och mineraler.

LÄS OCKSÅ: Vad räknas egentligen som skräpmat?

Det kallas skräpmat av en anledning
Skräpmat innehåller oftast billiga, lågkvalitativa ingredienser med minimalt med näring till maximal lönsamhet. Den mesta av vår favoriserade skräpmat faller under kategorin ”ultraprocessade livsmedel".
Detta enligt NOVA, ett livsmedelsklassificeringssystem som används av World Public Health and Nutrition Association, och som kategoriserar mat i fyra grupper: icke processade eller minimalt processade livsmedel (som oliver), processade kulinariska ingredienser (som olivolja), processade livsmedel (som fullkornsbröd och konserverade grönsaker) och ultraprocessade livsmedel (som de flesta favoritchips och kakor plus mycket av all snabbmat, både den färska och den vi hittar i frysdisken).

Processad mat lurar magen
Trots att många ultraprocessade livsmedel kan se ut som icke processade eller minimalt processade livsmedel erbjuder de varken mättnadskänsla eller näringsvärde.
När ett livsmedel processas bryts det ner i mindre delar, vilket gör att kroppen helt enkelt ser det som ”redan genomtuggat” och mer lättsmält och förser av den anledningen själva matsmältningsprocessen med mindre energi än den annars skulle göra. Och som sagt, näringsvärdet blir väsentligt lidande.

 

"Många ingredienser som uteslutande används industriellt"
– Många processade livsmedel innehåller ingredienser som uteslutande används industriellt, vilket i första hand innebär matutdrivning och kosmetiska tillsatser, säger Carlos Monteiro, professor i nutrition och folkhälsa vid universitetet i San Paulo, Brasilien.

LÄS OCKSÅ: Skräpmat kan eliminera ditt sug efter nyttig mat

Skräpmatstillverkning – ett komplext system av industriella processer
Varje enskild bearbetningsform kan påverka näringsinnehållet olika. En sädeskvarn, eller att blanchera grönsaker, kan till exempel destabilisera vitaminer som folat, tiamin och vitamin C.
Men – ultraprocessade livsmedel går igenom ett mycket mer komplext system av industriella processer än så.

Livsmedelstillverkare använder processmetoden "extrusion" (utdrivning) för att till exempel ändra utseendet eller isolera specifika näringsämnen som proteiner, kolhydrater och lipider från billiga varor som majs, soja och ärtor för att senare återföra dem igen och skapa slutprodukten.

Ett smörgåsbord av tillsatsämnen
Sedan används kosmetiska tillsatser som smakförstärkare, emulgeringsmedel och artificiella färger för att ersätta den konsistens, färg och smak som gått förlorad vid den högintensiva behandlingen av livsmedlet.
Ett exempel på en sådan tillsats är maltodextrin (som hittas i så gott som all välling i Sverige). Bland många andra.

Gällande chicken nuggets...
Professor Carlos Monteiro skrev så här i en artikel i tidskriften World Nutrition 2010.
"Vad gäller snabbmats-chicken-nuggets till exempel, innehåller dessa ”en mix av sådant som maskinellt tillvaratagits av de djurrester som annars skulle kasserats. Djurmaterialet blir till en skräpmatsingrediens på samma sätt som de raffinerade oljorna, stärkelsen och tillsatserna i produkten som är där för att tillsammans bilda något som ska se ut, lukta och smaka som en saftig friterad bit kyckling.”

 

Skräpmat stökar till vår hormonbalans
Ultraprocessade livsmedel rör även till det för våra hormoner, vilket kan vara en annan anledning till varför vi inte blir mätta av skräpmat.
Dessa processade livsmedel kan innehålla upp till åtta gånger så mycket socker som andra livsmedel, vilket bland annat kan bidra till en kraftig ökning av triglycerider i vårt blodomlopp (ett sorts fett i blodet som kroppen använder för att lagra energi).

Hormonet leptin hämmar hungerkänslan
Medan en viss nivå av triglycerider är hälsosam, kan för mycket triglycerider istället hämma vår förmåga att känna mättnad. Det beror på ett hormon som kallas leptin – även kallat vårt "mättnadshormon", vilket kommunicerar till vår hjärna när vi har fått nog att äta – och triglycerider kan blockera leptin från att passera genom blod-hjärnbarriären.

Aspartam kan påverka ämnesomsättningen
Viktigt att komma ihåg: Skräpmat med mindre socker eller sockerfri skräpmat är precis lika tomma på näring som alternativen med mycket socker. Faktum är att en studie från 2013 fann att vissa sockersubstitut, som aspartam, kan påverka vår metabolism negativt – vilket leder till att vi faktiskt äter mer.

LÄS OCKSÅ: Nu förses läsk med varningstext

Lightläsk ökar aptiten
Vad gäller light-läsk till exempel - där just aspartam är ett vanligt förekommande sötningsmedel - kan dessa öka vår aptit. Detta genom att erbjuda systemet "sötma-"faktorn men utan att leverera den energi din kropp förväntar sig.

Av Isabelle G Hedander 

Källa: Huffington Post


Skriv ut artikel


Nytt på Kurera

två kvinnor kör plankan

Vad är bäst? Kondition- eller styrketräning

Hälsa

Vi som gillar att träna pratar gärna länge och ofta om vad som är bästa sättet att träna. Är det styrketräning eller kanske konditionsträning? Färsk forskning visade att båda sätten är bra, men på olika sätt. Vill du slippa typ 2 diabetes ska du förbättra konditionen, men för viktnedgång och andra sjukdomar är valet inte lika uppenbart.

kvinna

Örten motade hormonell oro

Hälsa

För tre år sedan fick Gloria Tonnvik svår ångest. Humöret gick upp och ner och sömnlösheten tärde. Läkare gav diagnosen PMDS, en svårare form av PMS och hon fick antidepressiv medicin – men det ville inte Gloria ta. Lösningen kom i form av en ayurvedisk ört – ashwagandha.

kvinna tittar ut genom fönster

Naturlig hjälp mot depression

Hälsa

Håller oron på att ta över din vardag? Många lever med malande tankar – och även om det är helt naturligt så är det viktigt att vara vaksam på hur det påverkar livet och kroppen. Ett växtbaserat läkemedel med johannesört kan dämpa oro och ångest, utan biverkningar eller risk för beroende.

kvinna med hund

Så slapp Emelie knäsmärtan

Hälsa

En svår skidolycka trasade sönder knäet för Emelie von der Burg. Två operationer och en lyckosam rehabilitering gjorde henne bra igen. Men tio år senare började knät smärta – plötsligt och helt utan anledning. Då tog veterinären Emelie till samma metod som hon rekommenderar till djuren: ett tillskott med grönläppad mussla. Och nu är hon smärtfri igen.

 

Skål med kokosyoghurt toppad med bär och granola

Hemmagjord kokosyoghurt med probiotika

Recept

Njut av en egen yoghurt till frukost eller mellis, gjord på kokosmjölk och boostad med välgörande probiotika, men fri från tillsatser. Inspireras av detta recept från Kureras bloggare Sophie Bohnstedt. Allra godast blir den toppad med immunstärkande bär och knaprig granola.

 

händer som håller i havtronsbär

Det röda guldet som smörjer slemhinnorna

Hälsa

Fettsyran omega-7 återfuktar slemhinnor i hela kroppen. Ögon, mun och underliv, men också tarmen har slemhinnor som mår bättre av fettsyran. Dessutom gör den gott för huden. Sår läker snabbare och rynkor minskar på djupet. Havtornsbären från Tibet lär vara de mest antioxidantrika i hela världen. Redan efter en månad kommer effekten.

Närbild på bokomslaget "Magnus Carlsons hållbarhetsresa"

Magnus Carlson: Så gör du en klimatplan!

Eko/miljö

Många av oss vill göra något, eller mycket, för att rädda planeten. Men det är desto svårare att veta hur man ska bära sig åt. Någon som har lagt om sin livsstil och vet att det går är miljöengagerade sångaren Magnus Carlson från Weeping willows, som i sin nya bok presenterar hur du gör en klimatplan!

målad bild av hjärna där fjärilar flyger ut

Ny metod som ska bromsa Alzheimers sjukdom

Forskning

En ny behandlingsmetod att förhindra uppkomsten hos av Alzheimers sjukdom har utförts på möss – och resultaten är lovande. Forskare vid Uppsala universitet har lyckats öka nedbrytningen av de byggstenar som förhindrar ett protein att bilda klumpar och som gör att minnet försämras.

ansikten på 7 personer

5000 personer ska testa D-vitamin mot covid-19

Forskning

En stor klinisk studie ska undersöka om D-vitamin skyddar mot covid-19. Studien som getts namnet Coronavit kommer att pågå under sex månader och involvera hela 5 000 personer. Studien görs i Storbritannien där befolkningen generellt sett har låg D-vitaminstatus.

 

två personer springer

Så kan träning motverka cancer

Forskning

Den som drabbats av cancer rekommenderas att motionera eftersom prognosen då blir bättre. Det är inte helt klarlagt varför det förhåller sig på det viset, men nu har forskare vid Karolinska Institutet hittat en trolig förklaring. Fysisk aktivitet verkar kunna påverka de cytotoxiska T-cellerna så att de stärker deras förmåga att ge sig på cancercellerna.

Kvinna sitter i en säng med en kopp i handen

4 teer som hjälper dig att sova bättre

Naturlig hälsa

Naturliga örter som kamomill och citronmeliss kan hjälpa dig att somna lättare, minska antalet tillfällen du vaknar under natten samt förbättra sömnkvaliteten generellt. Allra mest effektivt blir örterna i koncentrerad form, i ett tillskott, men att dricka ett varmt te med örterna i utspädd form är också till hjälp.

 

En pudel får massage på en bänk

Så jobbar en djurhomeopat

Husdjur

Homeopati är en alternativ, holistisk behandlingsform med egna läkemedel för människor. Men det finns faktiskt även homeopati för djur, som då behandlas av djurhomeopater. Hur jobbar en sådan? Kurera frågade Annika Petrén och Sofie Rehndell, som bägge kan titulera sig djurhomeopater.

Närbild på en galette med cashewsmör med granatäpple

Glutenfri galette med granatäpple och cashewsmör

Recept

I det här receptet, signerat stjärnkocken Niklas Ekstedt, får du upptäcka den underbara franska galetten, här pyntad med granatäpple, mynta och cashewnötter! Till skillnad från "syskonet" crêpe är en galette mindre söt och mer aromatisk då den är gjord på glutenfritt bovetemjöl istället för vetemjöl.

tre kvinooansikten

Så kan din rosacea bli bättre

Hälsa

Rödhet eller rodnad på huden kan till exempel vara ytliga blodkärl eller rosacea. Kyla, värme och stress kan också göra huden rödflammig. Studier har visat ett en speciell molekyl som kommer från sackaros kan dämpa med röda området i ansiktet med upp till 68 procent.

 

man bär kvinna på ryggen

Naturens apotek: Uppiggande växter

Hälsa

När dagarna blir kortare och höstmörkret blir allt mer påtagligt hinner en del av oss aldrig ut i dagsljus. Då är det lätt att tappa ork och energi. Här är några pigga växter som ger kraft till både kropp och sinne.

Lingonbröd från boken "Systrarna Perssons skafferi"

Lingonbröd med anis

Recept

Vill du lyxa till vardagsfrukosten? Svep då ihop detta lingonbröd innan du går och lägger dig på kvällen och låt kalljäsa över natten. På morgonen är det bara att skjutsa in de färdigjästa bröden i ugnen - och voíla frukosten är serverad.