ljushårig kvinna håller fram ett äpple i höger hand och en glaserad munk i vänstra handen

Varför man kan äta skräpmat – och ändå inte bli mätt…

Du kan äta en hel massa skräpmat men är konstigt nog fortfarande hungrig. Trots att du nyss moffat i dig nära 2 000 kalorier känner du dig... ja, liksom inte nöjd.
Anledningen till detta, visar studier, är att din kropp vet saker som din hjärna inte vet.

Mättnad, alltså den mekanism som hindrar oss från att äta mer än vad vi behöver, har mindre att göra med kaloriintag och mer att göra med intag av särskilda makronäringsämnen – typer av protein, kolhydrater och fett – och den faktiska volymen mat, visar studier.

Kortvarig mättnad
När vi äter upp ett helt paket kakor får vi i oss mängder av kalorier, men inte den näring vi behöver för högkvalitativ, hållbar energi.
Och även om det kan tyckas en stor mängd mat (nåja, kakor) så rör den sig också snabbt genom oss, vilket innebär att mättnadskänslan inte heller håller i sig så länge.

LÄS OCKSÅ: Det här händer i kroppen när du äter en Big Mac

Vilken mättnadsgrad olika typer av kost ger oss beror delvis på dess näringsdensitet, alltså förhållandet mellan näringsämnen och kalorier. Trots att skräpmat är kaloririk förser den oss alltså bara med en mycket liten del näringsämnen i förhållande till mängden mat.

 

– Ofta när livsmedel inte ger oss nog mättnad beror det på att de inte är tillräckligt fiberrika, att de är för lättsmälta eller att de inte förser vår kropp med en jämn mängd kalorier under den tid matsmältningen tar, matsmältningen, säger Jeremy Furtado, forskare vid Harvard University, till Huffington Post.

Mängden näring avgör kvaliteten på mättnaden
Protein och kostfiber är avgörande för att kunna bromsa matsmältningen och frigöra energi under en längre period.
Även vitaminer och mineraler kan påverka hur mätta vi känner oss. Om din kropp inte får i sig de näringsämnen den behöver kan det göra att den fortsätter att skicka dig hungersignaler, i hopp om att du denna gång ska välja något mer näringsrikt

Skräpmat består i allmänhet av väldigt processade ingredienser som saknar både den makronäring du behöver för att känna dig mätt och naturligt förekommande vitaminer och mineraler.

LÄS OCKSÅ: Vad räknas egentligen som skräpmat?

Det kallas skräpmat av en anledning
Skräpmat innehåller oftast billiga, lågkvalitativa ingredienser med minimalt med näring till maximal lönsamhet. Den mesta av vår favoriserade skräpmat faller under kategorin ”ultraprocessade livsmedel".
Detta enligt NOVA, ett livsmedelsklassificeringssystem som används av World Public Health and Nutrition Association, och som kategoriserar mat i fyra grupper: icke processade eller minimalt processade livsmedel (som oliver), processade kulinariska ingredienser (som olivolja), processade livsmedel (som fullkornsbröd och konserverade grönsaker) och ultraprocessade livsmedel (som de flesta favoritchips och kakor plus mycket av all snabbmat, både den färska och den vi hittar i frysdisken).

Processad mat lurar magen
Trots att många ultraprocessade livsmedel kan se ut som icke processade eller minimalt processade livsmedel erbjuder de varken mättnadskänsla eller näringsvärde.
När ett livsmedel processas bryts det ner i mindre delar, vilket gör att kroppen helt enkelt ser det som ”redan genomtuggat” och mer lättsmält och förser av den anledningen själva matsmältningsprocessen med mindre energi än den annars skulle göra. Och som sagt, näringsvärdet blir väsentligt lidande.

 

"Många ingredienser som uteslutande används industriellt"
– Många processade livsmedel innehåller ingredienser som uteslutande används industriellt, vilket i första hand innebär matutdrivning och kosmetiska tillsatser, säger Carlos Monteiro, professor i nutrition och folkhälsa vid universitetet i San Paulo, Brasilien.

LÄS OCKSÅ: Skräpmat kan eliminera ditt sug efter nyttig mat

Skräpmatstillverkning – ett komplext system av industriella processer
Varje enskild bearbetningsform kan påverka näringsinnehållet olika. En sädeskvarn, eller att blanchera grönsaker, kan till exempel destabilisera vitaminer som folat, tiamin och vitamin C.
Men – ultraprocessade livsmedel går igenom ett mycket mer komplext system av industriella processer än så.

Livsmedelstillverkare använder processmetoden "extrusion" (utdrivning) för att till exempel ändra utseendet eller isolera specifika näringsämnen som proteiner, kolhydrater och lipider från billiga varor som majs, soja och ärtor för att senare återföra dem igen och skapa slutprodukten.

Ett smörgåsbord av tillsatsämnen
Sedan används kosmetiska tillsatser som smakförstärkare, emulgeringsmedel och artificiella färger för att ersätta den konsistens, färg och smak som gått förlorad vid den högintensiva behandlingen av livsmedlet.
Ett exempel på en sådan tillsats är maltodextrin (som hittas i så gott som all välling i Sverige). Bland många andra.

Gällande chicken nuggets...
Professor Carlos Monteiro skrev så här i en artikel i tidskriften World Nutrition 2010.
"Vad gäller snabbmats-chicken-nuggets till exempel, innehåller dessa ”en mix av sådant som maskinellt tillvaratagits av de djurrester som annars skulle kasserats. Djurmaterialet blir till en skräpmatsingrediens på samma sätt som de raffinerade oljorna, stärkelsen och tillsatserna i produkten som är där för att tillsammans bilda något som ska se ut, lukta och smaka som en saftig friterad bit kyckling.”

 

Skräpmat stökar till vår hormonbalans
Ultraprocessade livsmedel rör även till det för våra hormoner, vilket kan vara en annan anledning till varför vi inte blir mätta av skräpmat.
Dessa processade livsmedel kan innehålla upp till åtta gånger så mycket socker som andra livsmedel, vilket bland annat kan bidra till en kraftig ökning av triglycerider i vårt blodomlopp (ett sorts fett i blodet som kroppen använder för att lagra energi).

Hormonet leptin hämmar hungerkänslan
Medan en viss nivå av triglycerider är hälsosam, kan för mycket triglycerider istället hämma vår förmåga att känna mättnad. Det beror på ett hormon som kallas leptin – även kallat vårt "mättnadshormon", vilket kommunicerar till vår hjärna när vi har fått nog att äta – och triglycerider kan blockera leptin från att passera genom blod-hjärnbarriären.

Aspartam kan påverka ämnesomsättningen
Viktigt att komma ihåg: Skräpmat med mindre socker eller sockerfri skräpmat är precis lika tomma på näring som alternativen med mycket socker. Faktum är att en studie från 2013 fann att vissa sockersubstitut, som aspartam, kan påverka vår metabolism negativt – vilket leder till att vi faktiskt äter mer.

LÄS OCKSÅ: Nu förses läsk med varningstext

Lightläsk ökar aptiten
Vad gäller light-läsk till exempel - där just aspartam är ett vanligt förekommande sötningsmedel - kan dessa öka vår aptit. Detta genom att erbjuda systemet "sötma-"faktorn men utan att leverera den energi din kropp förväntar sig.

Av Isabelle G Hedander 

Källa: Huffington Post


Skriv ut artikel


Nytt på Kurera

Fett från fisk dämpar inflammationer i kroppen

Forskning

Balansen mellan ditt intag av omega-3 och omega-6 påverkar din risk för inflammation. En kost rik på omega-3 minskar risken att drabbas. Studierna på omega-3 har dock varit tvetydiga – vilket bland annat beror på att alla fiskoljor helt enkelt inte är lika. Uppsalaprofessorn Tom Saldeen har forskat på just fiskolja. Kurera bad honom förkla­ra varför vissa oljor inte har någon effekt alls – medan andra har en signifikant antiinflammatorisk effekt på bland annat hjärta, kärl och leder.

Enzymerna lugnade Karins mage

Hälsa

Ett aktivt liv med familj, karriär och träning. Men en mage som reagerar precis före ett spännande möte eller när spinningpasset ska börja, ställer till det. Lösningen – några kapslar med örter och enzymer.

“Mångfald och artrikedom gynnar alla bin”

Övrigt

Idag 20 maj firas honungbina över hela världen. I Slovenien, som ligger bakom införandet av World Bee Day, håller man honungsbiet högt och biodlingen har traditionellt hög status. I Danmark har det däremot utbrutit en infekterad konflikt mellan anhängare till de vilda bina och biodlarna och deras honungsbin. I Sverige menar forskare att konflikten är onödig.

 

5 enkla steg för att äta nyttigare

Kost

Jenny Westman och Linnea Eriksson är fullfjädrade hälsopedagoger och proffsiga matbloggare med ett välbesökt Instagramkonto, som är en total dröm för alla foodies. De utsågs till Årets hälsobloggare 2017 – och tycker att det är viktigt att fylla på kroppen med bra bränsle för att orka med livets alla utmaningar. Här delar de med sig av fem tips för hur du enkelt äter nyttigare – och avslöjar vad de själva äter för dagliga kosttillskott.

Smartphone med podden synlig - petra månström infälld

Kunskapsföretaget lanserar hälsopodd

Allmänt

Ihop med poddkändisen Petra Månström drar nu hälso- och kunskapsföretaget Holistic igång en ny podd. Tanken är att inspirera och sprida kunskap om nya vägar till hälsa och välmående - men utan pekpinnar och orimliga krav. "Tillsammans har vi skapat podden som jag så länge har letat efter. En podd som alla kan ta till sig", säger programledaren Petra Månström.

 

 

Nutritionisten: Vad är kalorirestriktion?

Kost

Kalorirestriktion är när man äter färre kalorier men ändå får i sig tillräckligt med näring. Det har länge varit känt att en minskning av intaget av kalorier främjar hälsan. Hälsosam kalorirestriktion ger positiva effekter på vikt och hjärt-kärlhälsa men extrem kalorirestriktion eller självsvält är varken bra för hälsan eller effektiv vid viktminskning, varnar Lina Åhlén.

Din favoritmusik aktiverar hjärnans belöningssystem

Mental hälsa

Dopamin spelar en direkt roll i den känsla av välmående som framkallas av att lyssna på musik vi tycker om visar en ny studie. Att lyssna på den musik du älskar gör att din hjärna frigör mer dopamin – en kemikalie som gör att vi känner oss engagerade och motiverade och som spelar en viktig roll för människans känslomässiga och kognitiva funktion. 

 

Större risk att dö efter operation för singlar och lågutbildade

Forskning

Det finns en tydlig koppling mellan sociala faktorer och risken att avlida efter bypassoperation. Personer som lever ensamma eller saknar vidareutbildning befinner sig i större utsträckning i riskzonen än personer som lever i par eller har "Det är första gången man kan se att de sociala förutsättningarna har så stark koppling till den förväntade livslängden efter operationen", säger Susanne Nielsen, forskare vid Göteborgs universitet.

Skönhetspanelen testar ansiktsmasker

Hud

Lägg en ansiktsmask – blunda och vila medan masken gör sitt på huden. Bättre boost för både hud och själ får man leta efter. Kureras skönhetspanel har testat några ekologiska ansiktsmasker och hittat en favorit.

 

Artros: Hjälper ingefära och gurkmeja?

TV

Flera studier på ingefära och kurkumin – den verksamma ingrediensen i gurkmeja – pekar enstämmigt på att dessa har antiinflammatoriska effekter. Forskarna vet till och med vilka komponenter i kroppen som örterna påverkar och hur – och har sett effekt vid bland annat artros.

Karin Björkegren Jones

”Det är aldrig för sent att investera i sin hälsa”

Intervju

Aldrig förr har det pratats så mycket om klimakteriet och kvinnors hälsa som nu. Yogaläraren, författaren och hälsoprofilen Karin Björkegren Jones har under 30 år belyst kvinnohälsa i artiklar, böcker, via yogan och nu i podden Kvinnoliv. Karin tycker att kvinnor ska kräva att bli lyssnade på när de söker vård. Det ska vara en självklarhet att ha rätt till olika behandlingsmetoder och mediciner och kanske det allra viktigaste – vi ska lära av våra erfarenheter och varandra och jobba förebyggande för att bibehålla hälsan långt upp i åren.

Nypon håller Sofies artros i schack

Hälsa

Artros i fingrarna höll på att sätta stopp för Sofie Turses dröm att bli fysioterapeut. Hon ville inte långtidsbehandla sin artros med traditionella värktabletter. Ett extrakt av strandnypon blev hennes räddning.