ljushårig kvinna håller fram ett äpple i höger hand och en glaserad munk i vänstra handen

Varför man kan äta skräpmat – och ändå inte bli mätt…

Du kan äta en hel massa skräpmat men är konstigt nog fortfarande hungrig. Trots att du nyss moffat i dig nära 2 000 kalorier känner du dig... ja, liksom inte nöjd.
Anledningen till detta, visar studier, är att din kropp vet saker som din hjärna inte vet.

Mättnad, alltså den mekanism som hindrar oss från att äta mer än vad vi behöver, har mindre att göra med kaloriintag och mer att göra med intag av särskilda makronäringsämnen – typer av protein, kolhydrater och fett – och den faktiska volymen mat, visar studier.

Kortvarig mättnad
När vi äter upp ett helt paket kakor får vi i oss mängder av kalorier, men inte den näring vi behöver för högkvalitativ, hållbar energi.
Och även om det kan tyckas en stor mängd mat (nåja, kakor) så rör den sig också snabbt genom oss, vilket innebär att mättnadskänslan inte heller håller i sig så länge.

LÄS OCKSÅ: Det här händer i kroppen när du äter en Big Mac

Vilken mättnadsgrad olika typer av kost ger oss beror delvis på dess näringsdensitet, alltså förhållandet mellan näringsämnen och kalorier. Trots att skräpmat är kaloririk förser den oss alltså bara med en mycket liten del näringsämnen i förhållande till mängden mat.

 

– Ofta när livsmedel inte ger oss nog mättnad beror det på att de inte är tillräckligt fiberrika, att de är för lättsmälta eller att de inte förser vår kropp med en jämn mängd kalorier under den tid matsmältningen tar, matsmältningen, säger Jeremy Furtado, forskare vid Harvard University, till Huffington Post.

Mängden näring avgör kvaliteten på mättnaden
Protein och kostfiber är avgörande för att kunna bromsa matsmältningen och frigöra energi under en längre period.
Även vitaminer och mineraler kan påverka hur mätta vi känner oss. Om din kropp inte får i sig de näringsämnen den behöver kan det göra att den fortsätter att skicka dig hungersignaler, i hopp om att du denna gång ska välja något mer näringsrikt

Skräpmat består i allmänhet av väldigt processade ingredienser som saknar både den makronäring du behöver för att känna dig mätt och naturligt förekommande vitaminer och mineraler.

LÄS OCKSÅ: Vad räknas egentligen som skräpmat?

Det kallas skräpmat av en anledning
Skräpmat innehåller oftast billiga, lågkvalitativa ingredienser med minimalt med näring till maximal lönsamhet. Den mesta av vår favoriserade skräpmat faller under kategorin ”ultraprocessade livsmedel".
Detta enligt NOVA, ett livsmedelsklassificeringssystem som används av World Public Health and Nutrition Association, och som kategoriserar mat i fyra grupper: icke processade eller minimalt processade livsmedel (som oliver), processade kulinariska ingredienser (som olivolja), processade livsmedel (som fullkornsbröd och konserverade grönsaker) och ultraprocessade livsmedel (som de flesta favoritchips och kakor plus mycket av all snabbmat, både den färska och den vi hittar i frysdisken).

Processad mat lurar magen
Trots att många ultraprocessade livsmedel kan se ut som icke processade eller minimalt processade livsmedel erbjuder de varken mättnadskänsla eller näringsvärde.
När ett livsmedel processas bryts det ner i mindre delar, vilket gör att kroppen helt enkelt ser det som ”redan genomtuggat” och mer lättsmält och förser av den anledningen själva matsmältningsprocessen med mindre energi än den annars skulle göra. Och som sagt, näringsvärdet blir väsentligt lidande.

 

"Många ingredienser som uteslutande används industriellt"
– Många processade livsmedel innehåller ingredienser som uteslutande används industriellt, vilket i första hand innebär matutdrivning och kosmetiska tillsatser, säger Carlos Monteiro, professor i nutrition och folkhälsa vid universitetet i San Paulo, Brasilien.

LÄS OCKSÅ: Skräpmat kan eliminera ditt sug efter nyttig mat

Skräpmatstillverkning – ett komplext system av industriella processer
Varje enskild bearbetningsform kan påverka näringsinnehållet olika. En sädeskvarn, eller att blanchera grönsaker, kan till exempel destabilisera vitaminer som folat, tiamin och vitamin C.
Men – ultraprocessade livsmedel går igenom ett mycket mer komplext system av industriella processer än så.

Livsmedelstillverkare använder processmetoden "extrusion" (utdrivning) för att till exempel ändra utseendet eller isolera specifika näringsämnen som proteiner, kolhydrater och lipider från billiga varor som majs, soja och ärtor för att senare återföra dem igen och skapa slutprodukten.

Ett smörgåsbord av tillsatsämnen
Sedan används kosmetiska tillsatser som smakförstärkare, emulgeringsmedel och artificiella färger för att ersätta den konsistens, färg och smak som gått förlorad vid den högintensiva behandlingen av livsmedlet.
Ett exempel på en sådan tillsats är maltodextrin (som hittas i så gott som all välling i Sverige). Bland många andra.

Gällande chicken nuggets...
Professor Carlos Monteiro skrev så här i en artikel i tidskriften World Nutrition 2010.
"Vad gäller snabbmats-chicken-nuggets till exempel, innehåller dessa ”en mix av sådant som maskinellt tillvaratagits av de djurrester som annars skulle kasserats. Djurmaterialet blir till en skräpmatsingrediens på samma sätt som de raffinerade oljorna, stärkelsen och tillsatserna i produkten som är där för att tillsammans bilda något som ska se ut, lukta och smaka som en saftig friterad bit kyckling.”

 

Skräpmat stökar till vår hormonbalans
Ultraprocessade livsmedel rör även till det för våra hormoner, vilket kan vara en annan anledning till varför vi inte blir mätta av skräpmat.
Dessa processade livsmedel kan innehålla upp till åtta gånger så mycket socker som andra livsmedel, vilket bland annat kan bidra till en kraftig ökning av triglycerider i vårt blodomlopp (ett sorts fett i blodet som kroppen använder för att lagra energi).

Hormonet leptin hämmar hungerkänslan
Medan en viss nivå av triglycerider är hälsosam, kan för mycket triglycerider istället hämma vår förmåga att känna mättnad. Det beror på ett hormon som kallas leptin – även kallat vårt "mättnadshormon", vilket kommunicerar till vår hjärna när vi har fått nog att äta – och triglycerider kan blockera leptin från att passera genom blod-hjärnbarriären.

Aspartam kan påverka ämnesomsättningen
Viktigt att komma ihåg: Skräpmat med mindre socker eller sockerfri skräpmat är precis lika tomma på näring som alternativen med mycket socker. Faktum är att en studie från 2013 fann att vissa sockersubstitut, som aspartam, kan påverka vår metabolism negativt – vilket leder till att vi faktiskt äter mer.

LÄS OCKSÅ: Nu förses läsk med varningstext

Lightläsk ökar aptiten
Vad gäller light-läsk till exempel - där just aspartam är ett vanligt förekommande sötningsmedel - kan dessa öka vår aptit. Detta genom att erbjuda systemet "sötma-"faktorn men utan att leverera den energi din kropp förväntar sig.

Av Isabelle G Hedander 

Källa: Huffington Post


Skriv ut artikel


Nytt på Kurera

folk sitter i trädgården och äter mat

Så många av oss har magproblem under semestern

Hälsa

Förändrade matvanor under semestern kan ge problem med magen. Under några veckors ledighet äter en majoritet av oss mat som ger magproblem. Sex av tio svenskar uppger att magen blir extra orolig på semestern. Några veckors avsteg från rutinerna är lätt att åtgärda. Probiotika kan enkelt lugna svullnad och kurrande magar.

bönor i skål

Fem skäl att äta mer bönor

Kost

Bönor är billiga, goda och du kan tillaga dom på många olika sätt.  Och skälen till att äta bönor och linser är många. Här följer en lista på baljväxter att tillaga som kan gynna din hälsa.



Tecknad jordglob på en tallrik och bestick

Missförstånden som ger ökat matsvinn

Eko/miljö

Tror du inte att din hantering av matrester och ditt sätt att planera och göra inköp av mat gör någon skillnad för miljön och klimatet på vår planet – eller för din egen plånbok för den delen? Dags att tänka om och minska ditt matsvinn!

kvinna håller i ett knä

Artros? Så får du hjälp!

Leder

Stela och värkande leder kan bero på artros. I Sverige uppskattas 800 000 personer vara drabbade av ledsjukdomen. Inget botemedel finns men med rätt träning, hjälpmedel och naturpreparat kan smärtan lindras, rörligheten förbättras och livskvaliteten öka.

olika kålsorter

Håll dig frisk med kål

Kost

Svenska naturen är full av nyttig mat. Ta en extra titt i grönsaksdisken efter kålsorter du inte känner till. Du kan laga både hälsosam och nyttig mat för en liten plånbok. Kål av olika slag är riktiga hälsobomber och har höga så kallade orac-värden.

 

kvinna tittar ut över vatten

Utmattad? Här är näringen för dig

Hälsa

Långvarig stress och för lite återhämtning bereder vägen för utmattningssyndrom. Du kan också drabbas av näringsbrister. Här är en lista på vitaminer, mineraler och örter som hjälper dig att komma tillbaka. Här är en lista på vitaminer, mineraler och örter som hjälper dig att komma tillbaka och må bra igen.

ärtor

Det här visste du inte om ärtor

Kost

Ärtor många hälsoegenskaper, förutom att de är smakrika. Bland annat har de en viktiga roll för aptitkontrollen samt ett högt proteininnehåll. Men du kanske inte visste att ärtan inte är en grönsak.

5 träningsklädda kvinnor

5 hemligheter bakom en vältränad kropp

Träning

Måste man träna varje dag och gå på diet för att skaffa sig en vältränad kropp eller bara ha väldigt bra gener? Nej, faktiskt inte. Hemligheten ligger i vanorna. Här är fem förhållningssätt som gör dig stark, frisk och vältränad.

darfor-ska-du-anvanda-oreganoolja

Därför ska du använda oreganoolja

Förkylning

Oreganooljan har använts i många hundratals år, bland annat som ett naturligt antibiotikum, och har flera hälsofördelar. Här listar Kureras näringsterapeut Zarah Öberg dess goda egenskaper – och även vad du bör tänka på vid användning.

 

Rawfoodsallad med gröna grönsaker och dressing

Rawfoodsallad med krämig cashewsås

Recept

Stärk din energinivå och ditt immunförsvar samtidigt som du kittlar smaklökarna med denna härliga, näringsrika rawfoodsallad med grönkål, broccoli, bladspenat och ruccola. Toppa med en krämig sås gjord på blötlagda cashewnötter, citron och vitlök. 

grönsaker och juice

Vill du rensa kroppen på toxiner? Kör en detoxvecka!

Kost

Krånglar magen? Har du huvudvärk, är ständigt trött och lättirriterad? Då kan det vara en god idé att låta mage och tarm vila genom att göra en fastevecka och låt kroppen få en välförtjänt vila. Resultat blir att du bland annat får en bättre fungerade mage, du blir piggare och får finare hy. Här får du tips på en veckas fasta.

Ensamheten bland unga ökar

Mental hälsa

Hur vi upplever vårt mående och skattar exempelvis vår sömn har försämrats de senaste 16 åren. Värst är problemen bland unga utan utbildning och kvinnor enligt en ny svensk studie som undersökt den upplevda hälsan hos personer i arbetsför ålder.

 

kvinna vid spegel

Maria Ahlgrens mat för vacker hud

Recept

Många funktioner som vi söker i hudvård finns i helt vanlig mat. Kroppens största organ är också vårt skyltfönster för insidan. Det säger Maria Ahlgren, skönhetsjournalist och författare till böcker om mat som gör oss vackrare – Beautyfood. Här kommer några recept från Marias bok.

kvinna hostar

Gia Fors: Förvärrar pyroluri covid-19?

Kurera debatt

Beror covid 19:s märkliga framfart med en blandning av obegripliga dödsfall, långvariga sjukdomsförlopp som går upp och ner samt milda förlopp som knappast märks på att de allvarligare fallen redan lider av pyroluri – en störning med försvårad avgiftning? Den frågan ställer sig Gia Fors, författare, reporter och friskvårds-terapeut i ett debattinlägg.

skoldkortelproblem-kom-palast-till-lakaren

Sköldkörtelproblem? Kom påläst till läkaren

Hälsa

År av lidande, felmedicinering och slussande mellan olika läkare. Många med sköldkörtelproblem vittnar om hur vägen till rätt hjälp kan vara både snårig och lång. Ett sätt att snabbare komma tillrätta med sina besvär är att komma påläst till doktorn. Här är en checklista inför läkarbesöket.

Ny upptäckt: Ägg kan välja spermier

Gravid/barn

Spännande forskning visar att ägg faktiskt kan välja spermier, vilket är en ny upptäckt inom fertilitetsforskningen. Denna interaktion mellan ägg och spermier kan förhoppningsvis hjälpa till att förstå de fall där det inte tydligt går att se varför ett visst par är infertilt.

 

två barn och mat

10 sätt att hindra att barn blir överviktiga som vuxna

Barn

Övervikt är ett stort problem som drabbar både barn och vuxna. Kosten är en del men att få barn att röra sig kan också vara svårt, tid framför skärmar av olika slag gör att barn rör sig mindre. En studie visar att närmare tre av tio amerikanska barn kommer vara överviktiga när de uppnår 35 års ålder och risken är stor att de förblir överviktiga.

hjärta med grönsaker

Oxidativ stress – en kropp i obalans

Forskning

Oxidativ stress, fria radikaler och antioxidanter. En del av termerna mer välbekanta än andra. Gemensam nämnare är att de alla påverkar vår hälsa. Magnus Nylander, medicine doktor och tandläkaren säger att en bil utan rostskydd rostar snart sönder, på grund av syrets angrepp. Vårt antioxidativa försvar motsvarar en bils rostskydd. Det antioxidativa försvaret kan sägas utgöra vårt inre ”rostskydd” som kan hejda syrets oxidativa skadeverkningar.

hund i hängmatta

Tio bästa tipsen för en hundvänlig semester

Husdjur

Åtta av tio hundägare tar med sig sin hund på semestern, något både hund och människa har glädje av. Miljöombyte, tid med familjen och roliga lekar står högt på önskelistan för vårt älskade husdjur. Här kommer några goda på hur du gör din semester mer hundvänlig.

 

boosta-immunforsvaret-naturens-apotek

Boosta immunförsvaret – naturens apotek

Eko/miljö

En sund livsstil är grunden för ett starkt och friskt immunförsvar - där spelar en god tarmflora och ett nervsystem i schack viktiga roller. Men det går också att hjälpa kroppen på traven genom olika läkeörter. Här tipsar örtspecialisten Lisen Sundgren om 12 av dem.

händer håller i hjärna

Ge bränsle åt hjärnan med MCT-olja

Kost

MCT-olja är medellånga mättade fettsyror med fantastiska egenskaper. MCT-oljan tas upp direkt av tarmen och bryts sedan ner i lever till ketoner. Ketonkropparna kan sedan transporteras rakt genom hjärnblodbarriären, utan hjälp av insulin, för att direkt förse hjärnan med energi.