Prenumerera på vårt nyhetsbrev!

Missa inga nyheter och erbjudanden från Kurera!
Vårt nyhetsbrev kommer två gånger i veckan och är helt gratis.
Anmäl dig genom att fylla i dina uppgifter här:

E-postadressen är nu registrerad, du kommer att få vårt nästa utskick!

ljushårig kvinna håller fram ett äpple i höger hand och en glaserad munk i vänstra handen

Varför man kan äta skräpmat – och ändå inte bli mätt

Du kan äta en hel massa skräpmat men är konstigt nog fortfarande hungrig. Trots att du nyss ätit nära 2000 kalorier känner du dig inte nöjd. Anledningen till detta, visar studier, är att din kropp vet saker som din hjärna inte vet.

Mättnad, alltså den mekanism som hindrar oss från att äta mer än vad vi behöver, har mindre att göra med kaloriintag och mer att göra med intag av särskilda makronäringsämnen – typer av protein, kolhydrater och fett – och den faktiska volymen mat, visar studier.

När vi äter upp ett helt paket kakor får vi i oss mängder av kalorier, men inte den näring vi behöver för högkvalitativ, hållbar energi.

Och även om det kan tyckas en stor mängd mat (nåja, kakor) så rör den sig också snabbt genom oss, vilket innebär att mättnadskänslan inte heller håller i sig så länge.

 

LÄS OCKSÅ: Det här händer i kroppen när du äter en Big Mac

Vilken mättnadsgrad olika typer av kost ger oss beror delvis på dess näringsdensitet, alltså förhållandet mellan näringsämnen och kalorier. Trots att skräpmat är kaloririk förser den oss alltså bara med en mycket liten del näringsämnen i förhållande till mängden mat.

– Ofta när livsmedel inte ger oss nog mättnad beror det på att de inte är tillräckligt fiberrika, att de är för lättsmälta eller att de inte förser vår kropp med en jämn mängd kalorier under den tid matsmältningen tar, matsmältningen, säger Jeremy Furtado, forskare vid Harvard University, till Huffington Post.

Mängden näring avgör kvaliteten på mättnaden

Protein och kostfiber är avgörande för att kunna bromsa matsmältningen och frigöra energi under en längre period.
Även vitaminer och mineraler kan påverka hur mätta vi känner oss. Om din kropp inte får i sig de näringsämnen den behöver kan det göra att den fortsätter att skicka dig hungersignaler, i hopp om att du denna gång ska välja något mer näringsrikt

Skräpmat består i allmänhet av väldigt processade ingredienser som saknar både den makronäring du behöver för att känna dig mätt och naturligt förekommande vitaminer och mineraler.

LÄS OCKSÅ: Vad räknas egentligen som skräpmat?

Det kallas skräpmat av en anledning
Skräpmat innehåller oftast billiga, lågkvalitativa ingredienser med minimalt med näring till maximal lönsamhet. Den mesta av vår favoriserade skräpmat faller under kategorin ”ultraprocessade livsmedel".
Detta enligt NOVA, ett livsmedelsklassificeringssystem som används av World Public Health and Nutrition Association, och som kategoriserar mat i fyra grupper: icke processade eller minimalt processade livsmedel (som oliver), processade kulinariska ingredienser (som olivolja), processade livsmedel (som fullkornsbröd och konserverade grönsaker) och ultraprocessade livsmedel (som de flesta favoritchips och kakor plus mycket av all snabbmat, både den färska och den vi hittar i frysdisken).

Processad mat lurar magen
Trots att många ultraprocessade livsmedel kan se ut som icke processade eller minimalt processade livsmedel erbjuder de varken mättnadskänsla eller näringsvärde.
När ett livsmedel processas bryts det ner i mindre delar, vilket gör att kroppen helt enkelt ser det som ”redan genomtuggat” och mer lättsmält och förser av den anledningen själva matsmältningsprocessen med mindre energi än den annars skulle göra. Och som sagt, näringsvärdet blir väsentligt lidande.

 

"Många ingredienser som uteslutande används industriellt"
– Många processade livsmedel innehåller ingredienser som uteslutande används industriellt, vilket i första hand innebär matutdrivning och kosmetiska tillsatser, säger Carlos Monteiro, professor i nutrition och folkhälsa vid universitetet i San Paulo, Brasilien.

LÄS OCKSÅ: Skräpmat kan eliminera ditt sug efter nyttig mat

Skräpmatstillverkning – ett komplext system av industriella processer
Varje enskild bearbetningsform kan påverka näringsinnehållet olika. En sädeskvarn, eller att blanchera grönsaker, kan till exempel destabilisera vitaminer som folat, tiamin och vitamin C.
Men – ultraprocessade livsmedel går igenom ett mycket mer komplext system av industriella processer än så.

Livsmedelstillverkare använder processmetoden "extrusion" (utdrivning) för att till exempel ändra utseendet eller isolera specifika näringsämnen som proteiner, kolhydrater och lipider från billiga varor som majs, soja och ärtor för att senare återföra dem igen och skapa slutprodukten.

Ett smörgåsbord av tillsatsämnen

Sedan används kosmetiska tillsatser som smakförstärkare, emulgeringsmedel och artificiella färger för att ersätta den konsistens, färg och smak som gått förlorad vid den högintensiva behandlingen av livsmedlet.
Ett exempel på en sådan tillsats är maltodextrin (som hittas i så gott som all välling i Sverige). Bland många andra.

Professor Carlos Monteiro skrev så här i en artikel i tidskriften World Nutrition 2010.
"Vad gäller snabbmats-chicken-nuggets till exempel, innehåller dessa ”en mix av sådant som maskinellt tillvaratagits av de djurrester som annars skulle kasserats. Djurmaterialet blir till en skräpmatsingrediens på samma sätt som de raffinerade oljorna, stärkelsen och tillsatserna i produkten som är där för att tillsammans bilda något som ska se ut, lukta och smaka som en saftig friterad bit kyckling.”

 

Skräpmat stökar till vår hormonbalans

Ultraprocessade livsmedel rör även till det för våra hormoner, vilket kan vara en annan anledning till varför vi inte blir mätta av skräpmat. Dessa processade livsmedel kan innehålla upp till åtta gånger så mycket socker som andra livsmedel, vilket bland annat kan bidra till en kraftig ökning av triglycerider i vårt blodomlopp (ett sorts fett i blodet som kroppen använder för att lagra energi).

Medan en viss nivå av triglycerider är hälsosam, kan för mycket triglycerider istället hämma vår förmåga att känna mättnad. Det beror på ett hormon som kallas leptin – även kallat vårt "mättnadshormon", vilket kommunicerar till vår hjärna när vi har fått nog att äta – och triglycerider kan blockera leptin från att passera genom blod-hjärnbarriären.

Aspartam kan påverka ämnesomsättningen

Viktigt att komma ihåg: Skräpmat med mindre socker eller sockerfri skräpmat är precis lika tomma på näring som alternativen med mycket socker. Faktum är att en studie från 2013 fann att vissa sockersubstitut, som aspartam, kan påverka vår metabolism negativt – vilket leder till att vi faktiskt äter mer.

LÄS OCKSÅ: Nu förses läsk med varningstext

Lightläsk ökar aptiten

Vad gäller light-läsk till exempel - där just aspartam är ett vanligt förekommande sötningsmedel - kan dessa öka vår aptit. Detta genom att erbjuda systemet "sötma-"faktorn men utan att leverera den energi din kropp förväntar sig.

Av Isabelle G Hedander 

Källa: Huffington Post


Skriv ut artikel


Nytt på Kurera

rysk rot

Trött? Prova rysk rot som snabbt ger energi

Naturlig hälsa

Rysk rot kallas också sibirisk ginseng och är den fysiska adaptogenen. Den har använts vid stressrelaterade besvär, utmattning och som en behandling för att undvika biverkningar av andra läkemedel på grund av örtens leverrenande effekt. Rysk rot har också används vid mental trötthet och impotens.

kvinna på badstrand

Drick mer och undvik urinvägsinfektion

Naturlig hälsa

Många har någon gång haft urinvägsinfektion och känner väl igen den brännande känslan vid urinering, och behovet av att ständigt gå på toaletten. Men gå känner till att något så enkelt som att dricka mer vatten kan bidra till att minska risken för att få besvär med urinvägarna.

flicka som blåser på maskros

Ogräsen som är riktigt nyttiga

Kost

Ogräs är inte bara dåligt. Det finns en anledning till att ogräs växer i ohejdat takt. Dessa är starka och när de växer under dåliga förutsättningar utvecklar de kraft. Många medicinalväxter är  vad vi kallar för ogräs. Här kommer några spännande ogräs att lägga på minnet.

 

kvinna tar sig för munnen

Lindra herpes på naturlig väg

Hälsa

Det är många som lider av herpes. Det finns rapporter om att åtta av tio har herpes typ 1, vilket oftast betyder att man får munsår. Cirka en av fyra svenskar har herpes typ 2, vilket betyder att man har det i underlivet. Det finns naturliga sätt att lindra smärtan av ett herpesutbrott.

bär

Bären som främjar god hälsa

Kost

När vi använder ordet superbär så beskriver det bär som är särskilt rika på antioxidanter, vitaminer och mineraler. Antioxidanter skyddar mot fria radikaler i kroppen, och kan likans vid ett rostskydd på bilen. Forskningar har visat att befolkningsgrupper med hög medellivslängd och låg sjukdomsförekomst har haft ett högt intag av antioxidanter. Här kommer några antioxidantrika bär.

kvinna serverar seniorer mat

Så ska undernäring hos äldre förhindras

Äldre

2017 kom en rapport från Socialstyrelsen som berättade att 40 000 personer som har äldreomsorg lider av undernäring och att fler än 100 000 riskerar att hamna där. I Sigtuna utbildar man personalen, men även seniorer som vill, för att komma tillrätta med problemet.

Ett par vilar

9 effektiva tips för att hjälpa sömnen på traven

Hälsa

Vi behöver sova tillräckligt för att må bra. Hjärnan repareras under natten och om du inte sover tillräckligt fungerar inte denna process optimalt. Anledningarna till sömnproblem kan vara många, och inte sällan går problemen i cykler. Här är några tips för att hjälpa sömnen på traven.

 

färgglad omelett på tallrik

Lunchtips: Grekisk omelett

Glutenfritt

Utsökt sälta från fetaost, härlig krämighet från avokado och protein från ägg gör det här till en snabb, enkel och somrig lunch full av näring. Granatäpple och valnötter ger förutom supernäring även ett skönt tuggmotstånd. 

 

kvinna som får skönhetsbehandling

IPL – kan det vara bra för huden?

Hud

Det finns en uppsjö av nya behandlingsformer med olika maskiner inom skönhetsindustrin. Fokus ligger på att förbättra hudkvalitén i ansikte, hals och på dekolltaget. Har du hört talas om IPL? Det är en form av mjukverkande laser som stimulerar kollagenet och ger en jämnare hudton.

kvinna och mygg

Variant av botox som skydd mot myggor

Eko/miljö

Pål Stenmark är professor i strukturell biokemi och han har belönats med ett pris för att ha hittat ett nytt botox-gift som fungerar mot malariamyggor. Insektsgifter är ofta väldigt miljöovänliga, men just detta botoxmedlet, som är ett protein, bryts ner i naturen och lämnar inte några onaturliga rester.

 

två kvinnor med former vid stranden

Därför går vi upp i vikt när vi blir äldre

Vikt

De allra flesta tycker nog att det blir allt svårare att hålla vikten i takt med att de blir äldre. Forskning från Karolinska Institutet visar att vi med åren får en minskad omsättning av fett – eller så kallade lipider – i fettväven, vilket gör att vi lättare går upp i vikt när vi blir äldre.

 

Kvinna före och efter viktnedgång

Så gjorde Mam Zuta sin fantastiska hälsoresa

Hälsa

I januari 2018 vägde Mam Zuta 100,5 kilo. Värken i kroppen gjorde att hon hade svårt att fungera i sitt vardagsliv. Då bestämde hon sig för att nu fick det vara nog. Hon började en hälsoresa som idag landat i 56 kilo och en kropp som många drömmer om.

flaskor och glas med fläder

Flädersaft utan citronsyra

Hälsa

Nu blommar flädern för fullt och det är dags att göra bär, saft, smoothies eller te. Fläderblommorna har traditionellt använts för dess hälsofrämjande egenskaper, bland annat vid förkylning. Men hoppa över citronsyran om du vill vara nyttig. Den utvinns ur svartmögel.

Sara Nomberg, hudvårdsexpert

Sara Nomberg: ”Jag är min egen försökskanin”

Hälsa

Hon är bara 30 år, men har redan drivit sitt eget hudvårdsmärke i över tio år. Kureras skönhetsexpert Sara Nomberg är eldsjälen som långt före de flesta andra förstod fördelarna med ekologisk hudvård. Men livet började på tuffast möjliga vis för Sara, som var nära att inte överleva barndomen.