ljushårig kvinna håller fram ett äpple i höger hand och en glaserad munk i vänstra handen

Varför man kan äta skräpmat – och ändå inte bli mätt…

Du kan äta en hel massa skräpmat men är konstigt nog fortfarande hungrig. Trots att du nyss moffat i dig nära 2 000 kalorier känner du dig… ja, liksom inte nöjd.
Anledningen till detta, visar studier, är att din kropp vet saker som din hjärna inte vet.

Mättnad, alltså den mekanism som hindrar oss från att äta mer än vad vi behöver, har mindre att göra med kaloriintag och mer att göra med intag av särskilda makronäringsämnen – typer av protein, kolhydrater och fett – och den faktiska volymen mat, visar studier.

Kortvarig mättnad
När vi äter upp ett helt paket kakor får vi i oss mängder av kalorier, men inte den näring vi behöver för högkvalitativ, hållbar energi.
Och även om det kan tyckas en stor mängd mat (nåja, kakor) så rör den sig också snabbt genom oss, vilket innebär att mättnadskänslan inte heller håller i sig så länge.

 

LÄS OCKSÅ: Det här händer i kroppen när du äter en Big Mac

Vilken mättnadsgrad olika typer av kost ger oss beror delvis på dess näringsdensitet, alltså förhållandet mellan näringsämnen och kalorier. Trots att skräpmat är kaloririk förser den oss alltså bara med en mycket liten del näringsämnen i förhållande till mängden mat.

– Ofta när livsmedel inte ger oss nog mättnad beror det på att de inte är tillräckligt fiberrika, att de är för lättsmälta eller att de inte förser vår kropp med en jämn mängd kalorier under den tid matsmältningen tar, matsmältningen, säger Jeremy Furtado, forskare vid Harvard University, till Huffington Post.

Mängden näring avgör kvaliteten på mättnaden
Protein och kostfiber är avgörande för att kunna bromsa matsmältningen och frigöra energi under en längre period.
Även vitaminer och mineraler kan påverka hur mätta vi känner oss. Om din kropp inte får i sig de näringsämnen den behöver kan det göra att den fortsätter att skicka dig hungersignaler, i hopp om att du denna gång ska välja något mer näringsrikt

Skräpmat består i allmänhet av väldigt processade ingredienser som saknar både den makronäring du behöver för att känna dig mätt och naturligt förekommande vitaminer och mineraler.

LÄS OCKSÅ: Vad räknas egentligen som skräpmat?

Det kallas skräpmat av en anledning
Skräpmat innehåller oftast billiga, lågkvalitativa ingredienser med minimalt med näring till maximal lönsamhet. Den mesta av vår favoriserade skräpmat faller under kategorin ”ultraprocessade livsmedel“.
Detta enligt NOVA, ett livsmedelsklassificeringssystem som används av World Public Health and Nutrition Association, och som kategoriserar mat i fyra grupper: icke processade eller minimalt processade livsmedel (som oliver), processade kulinariska ingredienser (som olivolja), processade livsmedel (som fullkornsbröd och konserverade grönsaker) och ultraprocessade livsmedel (som de flesta favoritchips och kakor plus mycket av all snabbmat, både den färska och den vi hittar i frysdisken).

Processad mat lurar magen
Trots att många ultraprocessade livsmedel kan se ut som icke processade eller minimalt processade livsmedel erbjuder de varken mättnadskänsla eller näringsvärde.
När ett livsmedel processas bryts det ner i mindre delar, vilket gör att kroppen helt enkelt ser det som ”redan genomtuggat” och mer lättsmält och förser av den anledningen själva matsmältningsprocessen med mindre energi än den annars skulle göra. Och som sagt, näringsvärdet blir väsentligt lidande.

“Många ingredienser som uteslutande används industriellt”
– Många processade livsmedel innehåller ingredienser som uteslutande används industriellt, vilket i första hand innebär matutdrivning och kosmetiska tillsatser, säger Carlos Monteiro, professor i nutrition och folkhälsa vid universitetet i San Paulo, Brasilien.

LÄS OCKSÅ: Skräpmat kan eliminera ditt sug efter nyttig mat

Skräpmatstillverkning – ett komplext system av industriella processer
Varje enskild bearbetningsform kan påverka näringsinnehållet olika. En sädeskvarn, eller att blanchera grönsaker, kan till exempel destabilisera vitaminer som folat, tiamin och vitamin C.
Men – ultraprocessade livsmedel går igenom ett mycket mer komplext system av industriella processer än så.

Livsmedelstillverkare använder processmetoden “extrusion” (utdrivning) för att till exempel ändra utseendet eller isolera specifika näringsämnen som proteiner, kolhydrater och lipider från billiga varor som majs, soja och ärtor för att senare återföra dem igen och skapa slutprodukten.

Ett smörgåsbord av tillsatsämnen
Sedan används kosmetiska tillsatser som smakförstärkare, emulgeringsmedel och artificiella färger för att ersätta den konsistens, färg och smak som gått förlorad vid den högintensiva behandlingen av livsmedlet.
Ett exempel på en sådan tillsats är maltodextrin (som hittas i så gott som all välling i Sverige). Bland många andra.

Gällande chicken nuggets…
Professor Carlos Monteiro skrev så här i en artikel i tidskriften World Nutrition 2010.
“Vad gäller snabbmats-chicken-nuggets till exempel, innehåller dessa ”en mix av sådant som maskinellt tillvaratagits av de djurrester som annars skulle kasserats. Djurmaterialet blir till en skräpmatsingrediens på samma sätt som de raffinerade oljorna, stärkelsen och tillsatserna i produkten som är där för att tillsammans bilda något som ska se ut, lukta och smaka som en saftig friterad bit kyckling.”

Skräpmat stökar till vår hormonbalans
Ultraprocessade livsmedel rör även till det för våra hormoner, vilket kan vara en annan anledning till varför vi inte blir mätta av skräpmat.
Dessa processade livsmedel kan innehålla upp till åtta gånger så mycket socker som andra livsmedel, vilket bland annat kan bidra till en kraftig ökning av triglycerider i vårt blodomlopp (ett sorts fett i blodet som kroppen använder för att lagra energi).

Hormonet leptin hämmar hungerkänslan
Medan en viss nivå av triglycerider är hälsosam, kan för mycket triglycerider istället hämma vår förmåga att känna mättnad. Det beror på ett hormon som kallas leptin – även kallat vårt “mättnadshormon”, vilket kommunicerar till vår hjärna när vi har fått nog att äta – och triglycerider kan blockera leptin från att passera genom blod-hjärnbarriären.

Aspartam kan påverka ämnesomsättningen
Viktigt att komma ihåg: Skräpmat med mindre socker eller sockerfri skräpmat är precis lika tomma på näring som alternativen med mycket socker. Faktum är att en studie från 2013 fann att vissa sockersubstitut, som aspartam, kan påverka vår metabolism negativt – vilket leder till att vi faktiskt äter mer.

LÄS OCKSÅ: Nu förses läsk med varningstext

Lightläsk ökar aptiten
Vad gäller light-läsk till exempel – där just aspartam är ett vanligt förekommande sötningsmedel – kan dessa öka vår aptit. Detta genom att erbjuda systemet “sötma-“faktorn men utan att leverera den energi din kropp förväntar sig.

Av Isabelle G Hedander 

Källa: Huffington Post


Skriv ut artikel


Nytt på Kurera

3 viktiga näringstips på våren

3 viktiga näringstips på våren

Hälsa

Våren är äntligen här – i alla fall så gott som. Men än påverkas våra kroppar både psykiskt och fysiskt av mörker och väderomslag och annat som hör årstiden till.  Här är tre näringstips som hjälper dig stå pall.

Läkaren som skriver recept på växtbaserad kost

Kost

Åsikterna om vad som är den optimala kosten för människan går isär, paleo säger vissa, LCHF säger andra och medan några går så långt som att påstå att vi är karnivorer, det vill säga renodlade köttätare menar andra att vi mår bäst av en helt växtbaserad kost. En av dem är läkaren Tobias Schmidt Hansen vars bok ”Den växtbaserade kosten” som han skrivit ihop med dietisten Maria Felding nyligen kom ut på svenska.

9 tecken på att du är på väg in i väggen

9 tecken på att du är på väg in i väggen

Mental hälsa

Stressrelaterad psykisk ohälsa är ett växande problem, både i Sverige och globalt.  Symtomen kommer smygande och att sätta stopp i tid är för många svårt – men oerhört viktigt. Tidiga insatser kan förhindra allvarlig sjukdom. Här är några viktiga signaler på att dina marginaler håller på att ta slut.

Min kropp säger att nyponen är bra

Hälsa

När man är så aktiv som Claes  så är det viktigt att kroppen hänger med och fungerar. När han märkte att kroppen blev allt stelare på morgnarna och kände sig orörlig och trög valde han att prova att äta strandnypon, trots att han var skeptisk.

olika strumpor

Rocka gärna sockorna – men tänk på det här

Krönikan

Susanne Wide skriver om en annan aspekt av  "rocka sockorna" – och uppmanar föräldrar och övriga vuxna att ta tillvara dagen som (ännu) en chans att prata med sina barn om att kanske låta flickan som gungar ensam få vara med, eller se den lilla pojken som kastar sten för sig själv i ett hörn. Och som gör det just för att de är, eller av någon anledning anses vara, annorlunda... Något som i verkligheten tyvärr bara är konstigt och allt annat än okej, menar hon.

Du rockar väl sockorna? Det här är Downs syndrom

Du rockar väl sockorna? Det här är Downs syndrom

Allmänt

Varje år föds omkring 120 barn med Downs syndrom i Sverige. Det motsvarar ett barn på cirka 800 födslar och är den vanligaste kromosomavvikelsen.  FN har utlyst 21 mars till Internationella Världsdagen för Downs syndrom. Dagen har blivit synonym med fenomenet "Rocka sockorna", där många sätter på sig eller barnen olika strumpor – för att hylla människors olikheter och stå upp för vårt lika värde.

Tävla och vinn boken “Den växtbaserade kosten”

Tävling

Tävla och vinn boken "Den växtbaserade kosten" där du kan lära dig mer om fördelarna av att äta växtbaserat från läkaren Tobias Schmidt Hansen och dietisten Maria Felding. I boken tar de upp myter och missförstånd och besvarar de vanligaste frågorna om vad det innebär att äta växtbaserat samt ger en praktisk introduktion.

Lär känna de fyra olika sömnfaserna

Hälsa

Visste du att alla människor går igenom fyra olika faser av sömn och att vi gör detta i cykler på mellan 90 och 120 minuter - flera gånger per natt? Sömnforskaren Christian Benedict förklarar allt om de fyra sömnfaserna.

Hjärnträning hjälper utmattade

Forskning

Många som drabbas av utmattningssyndrom får också problem med minne och koncentration. Nu visar ny forskning att det är möjligt att förbättra sina kognitiva funktioner – och att detta även kan ha positiva effekter på återhämtningsförloppet.

sågspån och trästockar

Sågspån – den nya maten?

Forskning

Nu ska sågspån och halm omvandlas till livsmedel.  Det är Miljö- och energidepartementet som nu gör en mångmiljonsatsning på klimatsmart mat – närmare bestämt på ett forskningsprojekt där trä ska göras ätbart genom fermentering. Satsningen skulle i förlängningen kunna innebära vinster för Sveriges skogs- och lantbruk.

3 superknep vid förkylning

3 superknep vid förkylning

Förkylning

Vid den här tiden på året, när våren står precis bakom dörren och vädret ser olika ut från dag till dag, är det lätt att bli förkyld. Vilket många gånger faktiskt är helt onödigt.  För de virushämmande knepen finns där – och ser man bara till att ta hand om sig i övrigt är chansen att hålla sig frisk större än många tror.  Här är infon som hjälper dig på vägen. 

Dansk duo bakom ny bok om växtbaserad kost

Kost

Det ökade intresset för miljö, etik och hälsa har lett till ett växande intresse för veganism och en mer växtbaserad kost. Många frågar sig om det verkligen är hälsosamt att bara äta mat från växtriket, mycket tyder på att de som äter växtbaserat löper lägre risk för många vanliga folksjukdomar. Det menar läkaren Tobias Schmidt Hansen och dietisten Maria Felding som skrivit boken "Den växtbaserade kosten".

“Vinterkräksjukan sprids via luften”

Mage

Det är högsäsong för vinterkräksjukan, och stora som små drabbas. Nu tror forskare att det smittsamma viruset kan transporteras i mycket små vattendroppar. Det gör att det i fortsättningen kan komma att räknas som luftburet och att det kan behövas andra metoder än vi hittills trott för att begränsa spridningen.

ögg

Nu är ägg farligt – igen

Forskning

Först var det farligt, sedan var det inte farligt, sedan var det farligt igen.  Äggens vara eller inte vara som livsmedel har diskuterats i decennier. Anledningen? Jo, huruvida ägget – på grund av sin mängd kolesterol, i främst gulan – är farligt för oss eller inte. Buden har varit olika. De senaste åren har ägg ansetts ofarliga på grund av tesen att kroppen faktiskt förmår kontrollera kolesterolmängden i blodet. Men – nu är de alltså farliga igen, enligt en ny studie presenterad i tidskriften Jama.

D-vitamin

Så länge räcker ditt lager av D-vitamin

Naturlig hälsa

Nu när solen är tillbaka, innebär det att du kan lägga undan burken med D-vitamin? undrar du. Eller tog du kanske aldrig fram den – eftersom du solgassade en hel del när du var i Thailand i julas – och tänker att ditt lager nog fortfarande räcker? Ja, det är inte helt lätt att veta hur det står till med kroppens D-vitamindepåer – så låt oss reda ut saken.

Nu slipper Marita nätter med värmevallningar

Hälsa

När Marita kom in i klimakteriet fick hon kraftiga värmevallningar och orolig sömn. Hon vaknade blöt av svett nästan varje natt. I somras började Marita ta ett växtbaserat läkemedel för klimakteriebesvär och efter ett tag var svettningarna i princip helt borta.

Skönhetspanelen testar: Ansiktsrengöring

Hud

Att tvätta ansiktet är något de flesta gör åtminstone en gång om dagen, vanligen på kvällen då vi vill bli rena från den smuts vi samlat på oss under dagen och ta bort eventuell make-up. Det finns många olika sorters rengöring att välja på men experter menar att krämer och geler är att föredra framför att tvätta sig med vanlig tvål som riskerar torka ut huden. Kureras skönhetspanel har testat fyra populära märken inom naturlig hudvård och utsett en favorit.

kvinna på soffa tar sig åt ryggen

En av tio har tyst njursjukdom

Allmänt

En av tio svenskar lider av kronisk njursjukdom, en sjukdom som både sänker livskvaliteten och kan bli livshotande. Men de flesta vet inte om att de är drabbad, trots att tidig upptäckt kan leda till att utvecklingen hinner bromsas. Det handlar om en tyst folksjukdom som ofta missas av vården – men helt i onödan, enligt experterna.  Det finns nämligen några enkla sätt att få en indikation på huruvida man är drabbad eller ej. Vilka får du veta mer om här.

Sallad med romantisk touch

Recept

Rödbetor, röda äpple och gojibär sprider ett rosa skimmer över denna enkla men goda sallad, varför inte bjuda på en både nyttig och välsmakande överraskning vid nästa romantiska tillfälle.

öga

Behandling vid glaukom – ögonsjukdomen många missar

Hälsa

Glaukom anses vara en lömsk sjukdom. Förloppet går så långsamt att många inte förstår att de är drabbade. Skulle de få diagnosen i tid skulle de sannolikt lyckas bromsa sjukdomen – som annars riskerar att göra dem blinda.  I och med Världsglaukomveckan 10-16 mars poängterar därför Glaukomförbundet vikten av att kontrollera sina ögon regelbundet – och Kureras näringsexpert Zarah Öberg tipsar om naturliga knep som kan förbättra läget för dem som fått sjukdomen konstaterad.

kvinna med selleriknippe och sellerijuice i glas

Hört talas om trenden sellerijuice? Detta sägs det vara bra för

Trendspaning

Din syster gör det, Robert DeNiro gör det, till och med din läkare gör det. Din granne gör det däremot ABSOLUT inte, avfärdar det tvärtom bestämt som en myt. Plötsligt har selleri, eller snarare sellerijuice, blivit någonting superhypat. Men varför har det blivit en sådan enorm hälsotrend, vad sägs sellerijuice vara så bra för – och hur ska man egentligen förhålla sig till hela grejen? Kurera har tittat närmare på sellerijuice-trenden, en av senare års absolut största virala hälsohyper.