ljushårig kvinna håller fram ett äpple i höger hand och en glaserad munk i vänstra handen

Varför man kan äta skräpmat – och ändå inte bli mätt…

Du kan äta en hel massa skräpmat men är konstigt nog fortfarande hungrig. Trots att du nyss moffat i dig nära 2 000 kalorier känner du dig... ja, liksom inte nöjd.
Anledningen till detta, visar studier, är att din kropp vet saker som din hjärna inte vet.

Mättnad, alltså den mekanism som hindrar oss från att äta mer än vad vi behöver, har mindre att göra med kaloriintag och mer att göra med intag av särskilda makronäringsämnen – typer av protein, kolhydrater och fett – och den faktiska volymen mat, visar studier.

Kortvarig mättnad
När vi äter upp ett helt paket kakor får vi i oss mängder av kalorier, men inte den näring vi behöver för högkvalitativ, hållbar energi.
Och även om det kan tyckas en stor mängd mat (nåja, kakor) så rör den sig också snabbt genom oss, vilket innebär att mättnadskänslan inte heller håller i sig så länge.

LÄS OCKSÅ: Det här händer i kroppen när du äter en Big Mac

Vilken mättnadsgrad olika typer av kost ger oss beror delvis på dess näringsdensitet, alltså förhållandet mellan näringsämnen och kalorier. Trots att skräpmat är kaloririk förser den oss alltså bara med en mycket liten del näringsämnen i förhållande till mängden mat.

 

– Ofta när livsmedel inte ger oss nog mättnad beror det på att de inte är tillräckligt fiberrika, att de är för lättsmälta eller att de inte förser vår kropp med en jämn mängd kalorier under den tid matsmältningen tar, matsmältningen, säger Jeremy Furtado, forskare vid Harvard University, till Huffington Post.

Mängden näring avgör kvaliteten på mättnaden
Protein och kostfiber är avgörande för att kunna bromsa matsmältningen och frigöra energi under en längre period.
Även vitaminer och mineraler kan påverka hur mätta vi känner oss. Om din kropp inte får i sig de näringsämnen den behöver kan det göra att den fortsätter att skicka dig hungersignaler, i hopp om att du denna gång ska välja något mer näringsrikt

Skräpmat består i allmänhet av väldigt processade ingredienser som saknar både den makronäring du behöver för att känna dig mätt och naturligt förekommande vitaminer och mineraler.

LÄS OCKSÅ: Vad räknas egentligen som skräpmat?

Det kallas skräpmat av en anledning
Skräpmat innehåller oftast billiga, lågkvalitativa ingredienser med minimalt med näring till maximal lönsamhet. Den mesta av vår favoriserade skräpmat faller under kategorin ”ultraprocessade livsmedel".
Detta enligt NOVA, ett livsmedelsklassificeringssystem som används av World Public Health and Nutrition Association, och som kategoriserar mat i fyra grupper: icke processade eller minimalt processade livsmedel (som oliver), processade kulinariska ingredienser (som olivolja), processade livsmedel (som fullkornsbröd och konserverade grönsaker) och ultraprocessade livsmedel (som de flesta favoritchips och kakor plus mycket av all snabbmat, både den färska och den vi hittar i frysdisken).

Processad mat lurar magen
Trots att många ultraprocessade livsmedel kan se ut som icke processade eller minimalt processade livsmedel erbjuder de varken mättnadskänsla eller näringsvärde.
När ett livsmedel processas bryts det ner i mindre delar, vilket gör att kroppen helt enkelt ser det som ”redan genomtuggat” och mer lättsmält och förser av den anledningen själva matsmältningsprocessen med mindre energi än den annars skulle göra. Och som sagt, näringsvärdet blir väsentligt lidande.

 

"Många ingredienser som uteslutande används industriellt"
– Många processade livsmedel innehåller ingredienser som uteslutande används industriellt, vilket i första hand innebär matutdrivning och kosmetiska tillsatser, säger Carlos Monteiro, professor i nutrition och folkhälsa vid universitetet i San Paulo, Brasilien.

LÄS OCKSÅ: Skräpmat kan eliminera ditt sug efter nyttig mat

Skräpmatstillverkning – ett komplext system av industriella processer
Varje enskild bearbetningsform kan påverka näringsinnehållet olika. En sädeskvarn, eller att blanchera grönsaker, kan till exempel destabilisera vitaminer som folat, tiamin och vitamin C.
Men – ultraprocessade livsmedel går igenom ett mycket mer komplext system av industriella processer än så.

Livsmedelstillverkare använder processmetoden "extrusion" (utdrivning) för att till exempel ändra utseendet eller isolera specifika näringsämnen som proteiner, kolhydrater och lipider från billiga varor som majs, soja och ärtor för att senare återföra dem igen och skapa slutprodukten.

Ett smörgåsbord av tillsatsämnen
Sedan används kosmetiska tillsatser som smakförstärkare, emulgeringsmedel och artificiella färger för att ersätta den konsistens, färg och smak som gått förlorad vid den högintensiva behandlingen av livsmedlet.
Ett exempel på en sådan tillsats är maltodextrin (som hittas i så gott som all välling i Sverige). Bland många andra.

Gällande chicken nuggets...
Professor Carlos Monteiro skrev så här i en artikel i tidskriften World Nutrition 2010.
"Vad gäller snabbmats-chicken-nuggets till exempel, innehåller dessa ”en mix av sådant som maskinellt tillvaratagits av de djurrester som annars skulle kasserats. Djurmaterialet blir till en skräpmatsingrediens på samma sätt som de raffinerade oljorna, stärkelsen och tillsatserna i produkten som är där för att tillsammans bilda något som ska se ut, lukta och smaka som en saftig friterad bit kyckling.”

 

Skräpmat stökar till vår hormonbalans
Ultraprocessade livsmedel rör även till det för våra hormoner, vilket kan vara en annan anledning till varför vi inte blir mätta av skräpmat.
Dessa processade livsmedel kan innehålla upp till åtta gånger så mycket socker som andra livsmedel, vilket bland annat kan bidra till en kraftig ökning av triglycerider i vårt blodomlopp (ett sorts fett i blodet som kroppen använder för att lagra energi).

Hormonet leptin hämmar hungerkänslan
Medan en viss nivå av triglycerider är hälsosam, kan för mycket triglycerider istället hämma vår förmåga att känna mättnad. Det beror på ett hormon som kallas leptin – även kallat vårt "mättnadshormon", vilket kommunicerar till vår hjärna när vi har fått nog att äta – och triglycerider kan blockera leptin från att passera genom blod-hjärnbarriären.

Aspartam kan påverka ämnesomsättningen
Viktigt att komma ihåg: Skräpmat med mindre socker eller sockerfri skräpmat är precis lika tomma på näring som alternativen med mycket socker. Faktum är att en studie från 2013 fann att vissa sockersubstitut, som aspartam, kan påverka vår metabolism negativt – vilket leder till att vi faktiskt äter mer.

LÄS OCKSÅ: Nu förses läsk med varningstext

Lightläsk ökar aptiten
Vad gäller light-läsk till exempel - där just aspartam är ett vanligt förekommande sötningsmedel - kan dessa öka vår aptit. Detta genom att erbjuda systemet "sötma-"faktorn men utan att leverera den energi din kropp förväntar sig.

Av Isabelle G Hedander 

Källa: Huffington Post


Skriv ut artikel


Nytt på Kurera

Årets miljöhjälte Magnus Carlson visar vägen till förändring

Eko/miljö

Magnus Carlson, sångare i bandet Weeping willows, utsågs nyligen till årets miljöhjälte och fick ta emot diplom ur kungens hand för sitt enträgna klimatarbete. Magnus lever som han lär, han har nästan helt slutat flyga, bandets turnéer sker med tåg och han slutade nyligen äta kött – för både hälsans och miljöns skull. Kurera växlade några ord med svenskt musiklivs kanske flitigaste miljökämpe. 

 

Elaine Jenderklint

Elaine fick tillbaka glans och liv i håret igen

Hälsa

För två år sedan kom cancern tillbaka och Elaine Jenderklints ena bröst opererades bort. I efterbehandlingen ingick hormontabletter – som gav starka biverkningar. Kroppen värkte och håret blev tunnare och livlöst, men ett tillskott med bland annat hirs har gett Elaine glansen och hårkvaliteten tillbaka.

Fredrik Ölander

Fiskolja lindrar inflammerad tarm

Mage

Inflammatoriska tarmsjukdomar som Chrons sjukdom och ulcerös kolit har en sak gemensamt – de kommer i skov. Studier har visat att ett tillskott av omega-3 är ett sätt att minska inflammation i tarmen och göra skoven färre och lindrigare. – Men var noga med att välja en fiskolja som är stabil och håller hög kvalitet, säger Fredrik Ölander, funktionsmedicinsk terapeut som dagligen träffar klienter med besvärliga magar.

Kaeng phet – röd currygryta med grönsaker

Recept

Denna thailändska gryta är fullproppad med av grönsaker. Detta och många andra goda vegetariska recept från hela världen hittar du i den gröna kokboken boken "Zeinas green kitchen" av matprofilen Zeina Mourtada – känd för sin uppskattade blogg "Zeinas kitchen" och sin medverkan i TV.

 

”Jag valde bort medicinen och blev frisk av träning och bra mat”

Hälsa

För tio år sedan när Benny Ottosson fick reda på att blodtrycket var förhöjt valde han bort medicinen och ändrade livsstil. På tre månader lyckades han sänka sitt blodtryck till normal nivå, men för två år sedan, när han fick en hudcancerdiagnos gjorde han en ny och djupare förändring – denna gång i sin inre värld. Om sin hälsoresa berättar Benny Ottosson i boken, "Frisk, lugn, utvilad, stark. Hela livet".

Kvinna som sitter i yogaställning

Naturens under lindrar ledbesvär

Forskning

Kådan boswellia och roten gurkmeja har i årtusenden använts inom den ayurvediska medicinen för att lindra ledbesvär. Ny forskning visar att effekten förstärks när de renodlas och används tillsammans så att ett plus ett inte bara blir två – utan tre.

Snart kan vi läsa av psykisk ohälsa i blodet

Mental hälsa

Det kommer ständigt nya siffror på att den psykiska ohälsan bland unga ökar men inte så mycket som visar på varför. Vid Uppsala universitet bedrivs sedan några år en studie som ska öka den kunskapen genom att bland annat studera gener för att göra det möjligt att ställa tidigare diagnoser.

Högt blodtryck – Så funkar det

Hjärt- kärlhälsa

Högt blodtryck är en av våra vanligaste hjärt-kärlsjukdomar, de flesta som drabbas är män. Högt blodtryck kan leda till flera allvarliga sjukdomar och bör därför tas på allvar. Mycket kan göras genom livsstilsförändringar och kostomläggning, hjälper inte det bör man överväga andra behandlingsmetoder.

 

Skönhetspanelen testar: body scrubs

Hud

Kall och torr luft på ingång betyder att det är dags att vårda huden lite extra. Genom att återfukta – och inte minst skrubba får du både lyster och en len hud. Kureras skönhetspanel har testat några naturliga kroppsskrubbar och hittat en favorit.

Glutenintoleranta får oftare selenbrist

Kost

Närmare tre procent av svenskarna har diagnosen celiaki - en autoimmun sjukdom som kräver livslång kostbehandling, och även om man äter rätt kan tarmen ha svårare att ta upp näring. Därför kan glutenintoleranta oftare lida av vitamin- och mineralbrist. Studier visar en tydlig koppling mellan glutenintolerans och bland annat brist på selen.

Peder Gustafsson

“Rödbetan boostar min träning”

Hälsa

Peder Gustafsson har idrottat i hela sitt liv. Numera är skidträningen det han satsar mest på och i årets Vasalopp kom han på 331 plats. Det tackar han åtminstone delvis ett tillskott med rödbetsextrakt för. Med hjälp av det kan han träna hårdare och orka mer.

 

Ann blev kvitt sina ständiga urinvägsinfektioner

Hälsa

Anns urinvägsinfektioner började för tio år sedan och hon har flera gånger om året behandlats med penicillin. – Jag har haft en enda urininfektion i mitt liv tidigare, men efter klimakteriet har det varit tre, fyra gånger om året. Sedan jag hittade tranbärsextraktet har infektionerna försvunnit helt, säger hon.

Växtbaserad kost kan lindra reumatoid artrit

Forskning

En växtbaserad kost kan bidra till att lindra smärtsamma symtom vid reumatid artrit.   Tidigare har man sett förbättringar hos patienter med fibromyalgi, mycket talar nu för att flera autoimmuna sjukdomar kan förebyggas med en kost basesrad på frukt och grönt.

apelsiner och citroner

Därför behöver immunförsvaret C-vitamin

Hälsa

Just nu lider miljontals människor i världen av C-vitaminbrist, en brist som till slut kan leda till olika sjukdomar och i sällsynta fall till döden. Immunologen Sanna Ehdin, forskare, föreläsare och författare, säger att C-vitamin stärker immunförsvaret och ger ökat motstånd mot infektioner, influensa och förkylning

 

“Nu är magen lugnare och jag är mitt pigga jag igen”

Hälsa

I många år tänkte Annette att magvärken var något hon fick stå ut med och lära sig att acceptera. När hon efter akuta magsmärtor på en semesterresa provade kisel blev magen lugnare och värken kommer nu allt mer sällan. – Jag är positivt överraskad att jag får så bra effekt. Jag behöver inte känna att jag måste gilla läget, säger hon.

Magsyran är viktig för mer än matsmältningen

Mage

För många är magsyra något som till varje pris ska kontrolleras, det kopplas till magkatarr och sura uppstötningar som vi tar läkemedel för att dämpa. Men flera problem beror på att vi har för lite snarare än för mycket och magsyran spelar en viktig roll inte bara för matsmältningen utan också för att hålla oss friska i övrigt.