Varför man kan äta skräpmat – och ändå inte bli mätt… | Kurera.se
ljushårig kvinna håller fram ett äpple i höger hand och en glaserad munk i vänstra handen

Varför man kan äta skräpmat – och ändå inte bli mätt…

Du kan äta en hel massa skräpmat men är konstigt nog fortfarande hungrig. Trots att du nyss moffat i dig nära 2 000 kalorier känner du dig... ja, liksom inte nöjd.
Anledningen till detta, visar studier, är att din kropp vet saker som din hjärna inte vet.

Mättnad, alltså den mekanism som hindrar oss från att äta mer än vad vi behöver, har mindre att göra med kaloriintag och mer att göra med intag av särskilda makronäringsämnen – typer av protein, kolhydrater och fett – och den faktiska volymen mat, visar studier.

Kortvarig mättnad
När vi äter upp ett helt paket kakor får vi i oss mängder av kalorier, men inte den näring vi behöver för högkvalitativ, hållbar energi.
Och även om det kan tyckas en stor mängd mat (nåja, kakor) så rör den sig också snabbt genom oss, vilket innebär att mättnadskänslan inte heller håller i sig så länge.

LÄS OCKSÅ: Det här händer i kroppen när du äter en Big Mac

Vilken mättnadsgrad olika typer av kost ger oss beror delvis på dess näringsdensitet, alltså förhållandet mellan näringsämnen och kalorier. Trots att skräpmat är kaloririk förser den oss alltså bara med en mycket liten del näringsämnen i förhållande till mängden mat.

 

– Ofta när livsmedel inte ger oss nog mättnad beror det på att de inte är tillräckligt fiberrika, att de är för lättsmälta eller att de inte förser vår kropp med en jämn mängd kalorier under den tid matsmältningen tar, matsmältningen, säger Jeremy Furtado, forskare vid Harvard University, till Huffington Post.

Mängden näring avgör kvaliteten på mättnaden
Protein och kostfiber är avgörande för att kunna bromsa matsmältningen och frigöra energi under en längre period.
Även vitaminer och mineraler kan påverka hur mätta vi känner oss. Om din kropp inte får i sig de näringsämnen den behöver kan det göra att den fortsätter att skicka dig hungersignaler, i hopp om att du denna gång ska välja något mer näringsrikt

Skräpmat består i allmänhet av väldigt processade ingredienser som saknar både den makronäring du behöver för att känna dig mätt och naturligt förekommande vitaminer och mineraler.

LÄS OCKSÅ: Vad räknas egentligen som skräpmat?

Det kallas skräpmat av en anledning
Skräpmat innehåller oftast billiga, lågkvalitativa ingredienser med minimalt med näring till maximal lönsamhet. Den mesta av vår favoriserade skräpmat faller under kategorin ”ultraprocessade livsmedel".
Detta enligt NOVA, ett livsmedelsklassificeringssystem som används av World Public Health and Nutrition Association, och som kategoriserar mat i fyra grupper: icke processade eller minimalt processade livsmedel (som oliver), processade kulinariska ingredienser (som olivolja), processade livsmedel (som fullkornsbröd och konserverade grönsaker) och ultraprocessade livsmedel (som de flesta favoritchips och kakor plus mycket av all snabbmat, både den färska och den vi hittar i frysdisken).

Processad mat lurar magen
Trots att många ultraprocessade livsmedel kan se ut som icke processade eller minimalt processade livsmedel erbjuder de varken mättnadskänsla eller näringsvärde.
När ett livsmedel processas bryts det ner i mindre delar, vilket gör att kroppen helt enkelt ser det som ”redan genomtuggat” och mer lättsmält och förser av den anledningen själva matsmältningsprocessen med mindre energi än den annars skulle göra. Och som sagt, näringsvärdet blir väsentligt lidande.

 

"Många ingredienser som uteslutande används industriellt"
– Många processade livsmedel innehåller ingredienser som uteslutande används industriellt, vilket i första hand innebär matutdrivning och kosmetiska tillsatser, säger Carlos Monteiro, professor i nutrition och folkhälsa vid universitetet i San Paulo, Brasilien.

LÄS OCKSÅ: Skräpmat kan eliminera ditt sug efter nyttig mat

Skräpmatstillverkning – ett komplext system av industriella processer
Varje enskild bearbetningsform kan påverka näringsinnehållet olika. En sädeskvarn, eller att blanchera grönsaker, kan till exempel destabilisera vitaminer som folat, tiamin och vitamin C.
Men – ultraprocessade livsmedel går igenom ett mycket mer komplext system av industriella processer än så.

Livsmedelstillverkare använder processmetoden "extrusion" (utdrivning) för att till exempel ändra utseendet eller isolera specifika näringsämnen som proteiner, kolhydrater och lipider från billiga varor som majs, soja och ärtor för att senare återföra dem igen och skapa slutprodukten.

Ett smörgåsbord av tillsatsämnen
Sedan används kosmetiska tillsatser som smakförstärkare, emulgeringsmedel och artificiella färger för att ersätta den konsistens, färg och smak som gått förlorad vid den högintensiva behandlingen av livsmedlet.
Ett exempel på en sådan tillsats är maltodextrin (som hittas i så gott som all välling i Sverige). Bland många andra.

Gällande chicken nuggets...
Professor Carlos Monteiro skrev så här i en artikel i tidskriften World Nutrition 2010.
"Vad gäller snabbmats-chicken-nuggets till exempel, innehåller dessa ”en mix av sådant som maskinellt tillvaratagits av de djurrester som annars skulle kasserats. Djurmaterialet blir till en skräpmatsingrediens på samma sätt som de raffinerade oljorna, stärkelsen och tillsatserna i produkten som är där för att tillsammans bilda något som ska se ut, lukta och smaka som en saftig friterad bit kyckling.”

 

Skräpmat stökar till vår hormonbalans
Ultraprocessade livsmedel rör även till det för våra hormoner, vilket kan vara en annan anledning till varför vi inte blir mätta av skräpmat.
Dessa processade livsmedel kan innehålla upp till åtta gånger så mycket socker som andra livsmedel, vilket bland annat kan bidra till en kraftig ökning av triglycerider i vårt blodomlopp (ett sorts fett i blodet som kroppen använder för att lagra energi).

Hormonet leptin hämmar hungerkänslan
Medan en viss nivå av triglycerider är hälsosam, kan för mycket triglycerider istället hämma vår förmåga att känna mättnad. Det beror på ett hormon som kallas leptin – även kallat vårt "mättnadshormon", vilket kommunicerar till vår hjärna när vi har fått nog att äta – och triglycerider kan blockera leptin från att passera genom blod-hjärnbarriären.

Aspartam kan påverka ämnesomsättningen
Viktigt att komma ihåg: Skräpmat med mindre socker eller sockerfri skräpmat är precis lika tomma på näring som alternativen med mycket socker. Faktum är att en studie från 2013 fann att vissa sockersubstitut, som aspartam, kan påverka vår metabolism negativt – vilket leder till att vi faktiskt äter mer.

LÄS OCKSÅ: Nu förses läsk med varningstext

Lightläsk ökar aptiten
Vad gäller light-läsk till exempel - där just aspartam är ett vanligt förekommande sötningsmedel - kan dessa öka vår aptit. Detta genom att erbjuda systemet "sötma-"faktorn men utan att leverera den energi din kropp förväntar sig.

Av Isabelle G Hedander 

Källa: Huffington Post


Skriv ut artikel


Nytt på Kurera

Spenat- och kesovåfflor med topping

Recept

Det jobbigaste med att göra våffor är att göra rent våffeljärnet efteråt. Resten är en barnlek. Så muta någon att ta hand om rengöringen och sätt igång! Dessa läckerheter från kokboken "Little green kitchen" fungerar både som matvåfflor och som efterrätt – välj själv vilken topping du vill använda.

 

Magsyrahämmande läkemedel kan öka risken för allergier

Forskning

Magsyrahämmande läkemedel är bland de vanligaste läkemedlen och säljs receptfritt i Sverige. Nu visar en ny studie att användningen av främst PPI ökar risken för att drabbas av olika allergier. Forskarna varnar nu för att ta dessa läkemedel i onödan och manar istället att komma till rätta med bakomliggande orsaker till magbesvären.

”Sockermonstret satt på min axel och väste in i mitt öra”

Krönikan

”Jag unnar mig att vara utan socker". "Jag unnar mig hälsa". Louise Hafdell har kommit långt under sina snart fem sockerfria år. Från att nästan ha varit styrd av sitt sockersug och ha sett godis som tröst i svåra situationer och det hon firade med när något gått bra är hon numera helt sockerfri. Räddningen när siffrorna på vågen stod som högst var – riktig mat.

 

 

Kurkumin bidrar till att minska smärta efter operation

Forskning

Gurkmeja anses ha många hälsofördelar och golden latte och gurkmejashots har på senare år seglat högt upp på listan av populära superfoods. Nu kommer dessutom glädjande nyheter från forskarsamhället – det verksamma ämnet i gurkmeja har visat sig avsevärt minska smärtan i samband med kirurgi.

Hjärtläkaren om det paradoxala med hälsosam kost

Kost

Det pågår en rörelse för att vi ska äta mer växtbaserat både för miljön och vår hälsas skull men den amerikanske hjärtläkaren Steven Gundry höjer ett varnande finger. Alla grönsaker är nämligen inte lika nyttiga, vissa kan till och med vara skadliga för vår hälsa skriver han i sin bok ”Växtparadoxen”.

 

Bakterier i äpplen bidrar till en sund tarmmiljö

Forskning

Effekten av ett äpple om dagen för att hålla läkaren borta kan till stor del anses bero på de gynnsamma bakterier som koloniserar äpplet och därefter tarmen, enligt forskare. Forskningen styrker även att det går att känna skillnad på smaken mellan ekologisk frukt och konventionella äpplen.

Doktor Gillbros 10 budord för frisk och spänstig hud

Hud

I boken "Hudbibeln" summerar Johanna Gillbro, doktor inom experimentell och klinisk dermatologi sin omfattande kunskap inom hud och hudvård. I boken "Hudbibeln" delar hon med sig av sin kunskap och ger tips om hur man bäst tar hand om huden både utifrån och inifrån för i lokhet med många andra vet Johanna att skönhet även kommer inifrån.

 

Två klassiska pastarätter på vegovis

Recept

Tvekar du att lägga om till vegansk eller vegetarisk kost av rädsla för att inte längre kunna njuta av dina favoriträtter som spagetti bolognese eller lasagne? Lugn, det råder läkaren Veronica Hedberg och kokboksförfattaren och journalisten Susanne Hovenäs bot på. I nya boken "Smart mat för en frisk kropp och hjärna" finns flera goda recept att botanisera bland och Kurera kan bjuda på två smakprov. 

Växtbaserad mat – smart för kropp och hjärna

Kost

I år minskade köttkonsumtionen i Sverige för andra året i rad och ligger nu på samma nivå som den var 2007. Vi har fortfarande en bit kvar innan vi befinner oss på den nivå vi var innan Svreige gick med i EU och priset på kött sjönk men utvecklingen tycks gå stadigt nedåt. I takt med det ökar intresset för vegansk eller växtbaserad mat och i dagarna släpptes en ny bok med helt växtbaserade recept.

Tävla och vinn albumet “Svart katt”

Tävling

Sångerskan Cecilia Thorngrens album "Svart katt" fick ett varmt mottagande när det kom ut. Nu har du chansen att vinna ett signerat exemplar med låtar ur den svenska visskatten samt nyskrivet material av Staffan Hellstrand och Peter Le Marc.